PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa015949
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family HD-ZIP
Protein Properties Length: 349aa    MW: 38949.9 Da    PI: 8.7719
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58680836PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.61.9e-17208262256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                rk+ ++tk+q   Lee F+ ++ ++++++ eLA++l+L+ rqV vWFqNrRa+ k
  Lsa015949 208 RKKLRLTKQQSAYLEESFKDHSILNHRQKLELARQLNLNPRQVEVWFQNRRARTK 262
                678899***********************************************98 PP

2HD-ZIP_I/II120.58.5e-39208298192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  +kk+rl+k+q++ LEesF+ ++ L++++K elar+L+l+prqv+vWFqnrRARtk+kq+E+dye+Lk+++++l+ en+rL+ke +eLr +lk
    Lsa015949 208 RKKLRLTKQQSAYLEESFKDHSILNHRQKLELARQLNLNPRQVEVWFQNRRARTKLKQTEMDYEYLKNCCETLTGENRRLHKEIQELR-ALK 298
                  69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.086204264IPR001356Homeobox domain
SMARTSM003897.8E-13206268IPR001356Homeobox domain
SuperFamilySSF466893.97E-18208273IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.6E-17208271IPR009057Homeodomain-like
PfamPF000466.7E-15208262IPR001356Homeobox domain
CDDcd000863.66E-15208265No hitNo description
PROSITE patternPS000270239262IPR017970Homeobox, conserved site
PfamPF021831.1E-10264298IPR003106Leucine zipper, homeobox-associated
SMARTSM003406.7E-21264307IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MELGLGLSLG NKSCKKFHGI TTKIPAAAPT FPSAADSSSV GFCMALTINA IYGTNKKRAN  60
DDSNKKDDQT TFEDLEGLKE SPRIKAIIDG REKVLQLNPP LQLDLLPVPD HTLVNRHAPS  120
LPWSSDNGNS HGGSSENLLA ATGFDVKSTP PGTMGTEEAT SSLRLDFYSS SRTANVLRNK  180
SFELINDVVE MQRGASRASD EDHNGIYRKK LRLTKQQSAY LEESFKDHSI LNHRQKLELA  240
RQLNLNPRQV EVWFQNRRAR TKLKQTEMDY EYLKNCCETL TGENRRLHKE IQELRALKTT  300
SNPFNLQLQP TTLTMCRSCE LVAATTYTIT PAPPSTKFLN TPLSDNSSH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1256264RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009617361.13e-85PREDICTED: homeobox-leucine zipper protein HOX11-like
RefseqXP_016500773.13e-85PREDICTED: homeobox-leucine zipper protein HOX11-like
TrEMBLA0A103Y1991e-105A0A103Y199_CYNCS; Homeobox, conserved site-containing protein
STRINGPOPTR_0009s02850.11e-72(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.15e-62homeobox from Arabidopsis thaliana